PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK31474.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family WRKY
Protein Properties Length: 283aa    MW: 32214.3 Da    PI: 7.1687
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK31474.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.17.7e-33138195259
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 +Dgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+vers +dp+vv++tYe++Hnh+
  KFK31474.1 138 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCTVKKRVERSYQDPTVVITTYESQHNHP 195
                 8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381306.3E-1002283IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.803.8E-34122197IPR003657WRKY domain
SuperFamilySSF1182904.84E-29129197IPR003657WRKY domain
PROSITE profilePS5081132.214132197IPR003657WRKY domain
SMARTSM007741.4E-37137196IPR003657WRKY domain
PfamPF031062.2E-25138195IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0051607Biological Processdefense response to virus
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:1901002Biological Processpositive regulation of response to salt stress
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MISSQNGSDL HLSPQGAYDL GFELSPSSSE FFSSSIDQEN GLYDAINYNS SHKSHEVVGG  60
AGATIKNEIR VSASPSSSEA DHHPGEDSGK IRRKREAGDG GEDDQPSQKV IKTKKKEEKK  120
QKEPRVSFMT KTEVDHLEDG YRWRKYGQKA VKNSPYPRSY YRCTTQKCTV KKRVERSYQD  180
PTVVITTYES QHNHPIPTSR RTAMFTGSVQ SDYNSSSLSP LSDFIINTPR SFSHDDLFRV  240
PYASANVNPN YHQQQQQNQE FQHESEYELL KEMFPSVFFK HEP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-28127197777Probable WRKY transcription factor 4
2lex_A2e-28127197777Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00545DAPTransfer from AT5G46350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013610444.11e-162PREDICTED: probable WRKY transcription factor 8
SwissprotQ9FL261e-153WRKY8_ARATH; Probable WRKY transcription factor 8
TrEMBLA0A087GNM20.0A0A087GNM2_ARAAL; Uncharacterized protein
STRINGBra017561.1-P1e-160(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15242693
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46350.11e-140WRKY DNA-binding protein 8